Polyclonal Rabbit anti-Human SLC16A4 Antibody (IHC, WB) LS-C335286

Artikelnummer: LS-C335286-20
Artikelname: Polyclonal Rabbit anti-Human SLC16A4 Antibody (IHC, WB) LS-C335286
Artikelnummer: LS-C335286-20
Hersteller Artikelnummer: LS-C335286-20
Alternativnummer: LS-C335286-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC16A4 (NP_004687.1). KNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVS
Konjugation: Unconjugated
Alternative Synonym: SLC16A4, MCT 5, MCT4, MCT5, Monocarboxylate transporter 5, Monocarboxylate transporter 4, MCT 4
SLC16A4 antibody LS-C335286 is an unconjugated rabbit polyclonal antibody to SLC16A4 from human. It is reactive with human and mouse. Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 9122
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IHC (1:50 - 1:200), WB (1:1000 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 35kDa/42kDa/46kDa/49kDa/54kDa, while the observed MW by Western blot was 54kDa.
Western blot analysis of extracts of mouse muscle tissue lysate.
Immunohistochemistry of paraffin-embedded human esophagus cancer tissue.