Polyclonal Rabbit anti-Human SLC16A4 Antibody (IHC, WB) LS-C335286

Catalog Number: LS-C335286-20
Article Name: Polyclonal Rabbit anti-Human SLC16A4 Antibody (IHC, WB) LS-C335286
Biozol Catalog Number: LS-C335286-20
Supplier Catalog Number: LS-C335286-20
Alternative Catalog Number: LS-C335286-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC16A4 (NP_004687.1). KNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVS
Conjugation: Unconjugated
Alternative Names: SLC16A4, MCT 5, MCT4, MCT5, Monocarboxylate transporter 5, Monocarboxylate transporter 4, MCT 4
SLC16A4 antibody LS-C335286 is an unconjugated rabbit polyclonal antibody to SLC16A4 from human. It is reactive with human and mouse. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 9122
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:200), WB (1:1000 - 1:2000)
Application Notes: The predicted MW is 35kDa/42kDa/46kDa/49kDa/54kDa, while the observed MW by Western blot was 54kDa.
Western blot analysis of extracts of mouse muscle tissue lysate.
Immunohistochemistry of paraffin-embedded human esophagus cancer tissue.