Polyclonal Rabbit anti-Human FLI1 Antibody (IHC, IF, WB) LS-C335594

Artikelnummer: LS-C335594-100
Artikelname: Polyclonal Rabbit anti-Human FLI1 Antibody (IHC, IF, WB) LS-C335594
Artikelnummer: LS-C335594-100
Hersteller Artikelnummer: LS-C335594-100
Alternativnummer: LS-C335594-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLI1 (NP_002008.2). MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPM
Konjugation: Unconjugated
Alternative Synonym: FLI1, FLI-1, EWSR2, SIC-1, Proto-oncogene Fli-1, Transcription factor ERGB, Fli-1 oncogene
FLI1 antibody LS-C335594 is an unconjugated rabbit polyclonal antibody to human FLI1. Validated for IF, IHC, IP and WB.
Klonalität: Polyclonal
NCBI: 2313
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:50 - 1:100), IHC (1:50 - 1:200), IP (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 29kDa/43kDa/47kDa/50kDa, while the observed MW by Western blot was 43kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded human lung cancer tissue.
Immunofluorescence analysis of U2OS cells.