Polyclonal Rabbit anti-Human FLI1 Antibody (IHC, IF, WB) LS-C335594

Catalog Number: LS-C335594-100
Article Name: Polyclonal Rabbit anti-Human FLI1 Antibody (IHC, IF, WB) LS-C335594
Biozol Catalog Number: LS-C335594-100
Supplier Catalog Number: LS-C335594-100
Alternative Catalog Number: LS-C335594-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLI1 (NP_002008.2). MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPM
Conjugation: Unconjugated
Alternative Names: FLI1, FLI-1, EWSR2, SIC-1, Proto-oncogene Fli-1, Transcription factor ERGB, Fli-1 oncogene
FLI1 antibody LS-C335594 is an unconjugated rabbit polyclonal antibody to human FLI1. Validated for IF, IHC, IP and WB.
Clonality: Polyclonal
NCBI: 2313
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:50 - 1:100), IHC (1:50 - 1:200), IP (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 29kDa/43kDa/47kDa/50kDa, while the observed MW by Western blot was 43kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded human lung cancer tissue.
Immunofluorescence analysis of U2OS cells.