Polyclonal Rabbit anti-Human LHFPL2 Antibody (WB) LS-C747941

Artikelnummer: LS-C747941-20
Artikelname: Polyclonal Rabbit anti-Human LHFPL2 Antibody (WB) LS-C747941
Artikelnummer: LS-C747941-20
Hersteller Artikelnummer: LS-C747941-20
Alternativnummer: LS-C747941-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human LHFPL2 (NP_005770.1). SADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQAT
Konjugation: Unconjugated
Alternative Synonym: LHFPL2, KIAA0206, LHFP-like protein 2
LHFPL2 antibody LS-C747941 is an unconjugated rabbit polyclonal antibody to LHFPL2 from human. It is reactive with human and mouse. Validated for WB.
Klonalität: Polyclonal
NCBI: 10184
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 24kDa, while the observed MW by Western blot was 24kDa.
494,00 €
20 µl
* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL