Polyclonal Rabbit anti-Human LHFPL2 Antibody (WB) LS-C747941

Catalog Number: LS-C747941-20
Article Name: Polyclonal Rabbit anti-Human LHFPL2 Antibody (WB) LS-C747941
Biozol Catalog Number: LS-C747941-20
Supplier Catalog Number: LS-C747941-20
Alternative Catalog Number: LS-C747941-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human LHFPL2 (NP_005770.1). SADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQAT
Conjugation: Unconjugated
Alternative Names: LHFPL2, KIAA0206, LHFP-like protein 2
LHFPL2 antibody LS-C747941 is an unconjugated rabbit polyclonal antibody to LHFPL2 from human. It is reactive with human and mouse. Validated for WB.
Clonality: Polyclonal
NCBI: 10184
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 24kDa, while the observed MW by Western blot was 24kDa.