Polyclonal Rabbit anti-Human FCER1G Antibody (WB) LS-C747959

Artikelnummer: LS-C747959-100

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human FCER1G Antibody (WB) LS-C747959
Artikelnummer:	LS-C747959-100
Hersteller Artikelnummer:	LS-C747959-100
Alternativnummer:	LS-C747959-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1). LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Konjugation:	Unconjugated
Alternative Synonym:	FCER1G, FceRI gamma, IgE Fc receptor subunit gamma, FcRgamma, Gamma polypeptide, Fc receptor gamma-chain, Fc-epsilon RI-gamma, FCRG

FCER1G antibody LS-C747959 is an unconjugated rabbit polyclonal antibody to FCER1G from human. It is reactive with human, mouse and rat. Validated for WB.

Klonalität:	Polyclonal
NCBI:	2207
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:1000 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 9kDa, while the observed MW by Western blot was 12kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten