Polyclonal Rabbit anti-Human FCER1G Antibody (WB) LS-C747959

Catalog Number: LS-C747959-100

Images (0)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human FCER1G Antibody (WB) LS-C747959
Biozol Catalog Number:	LS-C747959-100
Supplier Catalog Number:	LS-C747959-100
Alternative Catalog Number:	LS-C747959-100
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1). LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Conjugation:	Unconjugated
Alternative Names:	FCER1G, FceRI gamma, IgE Fc receptor subunit gamma, FcRgamma, Gamma polypeptide, Fc receptor gamma-chain, Fc-epsilon RI-gamma, FCRG

FCER1G antibody LS-C747959 is an unconjugated rabbit polyclonal antibody to FCER1G from human. It is reactive with human, mouse and rat. Validated for WB.

Clonality:	Polyclonal
NCBI:	2207
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	WB (1:1000 - 1:2000)
Application Notes:	The predicted MW is 9kDa, while the observed MW by Western blot was 12kDa.

* VAT and and shipping costs not included.
Errors and price changes excepted