Polyclonal Rabbit anti-Human TAL1 Antibody (WB) LS-C747995

Artikelnummer: LS-C747995-100
Artikelname: Polyclonal Rabbit anti-Human TAL1 Antibody (WB) LS-C747995
Artikelnummer: LS-C747995-100
Hersteller Artikelnummer: LS-C747995-100
Alternativnummer: LS-C747995-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 242-331 of human TAL1 (NP_003180.1). LLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR
Konjugation: Unconjugated
Alternative Synonym: TAL1, SCL, Stem cell protein, Tal-1, TCL5, BHLHa17, Tal-1 product
TAL1 antibody LS-C747995 is an unconjugated rabbit polyclonal antibody to TAL1 from human. It is reactive with human and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 6886
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 16kDa/31kDa/34kDa, while the observed MW by Western blot was 50kDa.