Polyclonal Rabbit anti-Human TAL1 Antibody (WB) LS-C747995

Catalog Number: LS-C747995-100
Article Name: Polyclonal Rabbit anti-Human TAL1 Antibody (WB) LS-C747995
Biozol Catalog Number: LS-C747995-100
Supplier Catalog Number: LS-C747995-100
Alternative Catalog Number: LS-C747995-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 242-331 of human TAL1 (NP_003180.1). LLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR
Conjugation: Unconjugated
Alternative Names: TAL1, SCL, Stem cell protein, Tal-1, TCL5, BHLHa17, Tal-1 product
TAL1 antibody LS-C747995 is an unconjugated rabbit polyclonal antibody to TAL1 from human. It is reactive with human and rat. Validated for WB.
Clonality: Polyclonal
NCBI: 6886
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 16kDa/31kDa/34kDa, while the observed MW by Western blot was 50kDa.