Polyclonal Rabbit anti-Human NDUFA4L2 Antibody (WB) LS-C749292

Artikelnummer: LS-C749292-20

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human NDUFA4L2 Antibody (WB) LS-C749292
Artikelnummer:	LS-C749292-20
Hersteller Artikelnummer:	LS-C749292-20
Alternativnummer:	LS-C749292-20
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human NDUFA4L2 (NP_064527.1). MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF
Konjugation:	Unconjugated
Alternative Synonym:	NDUFA4L2, NUOMS

NDUFA4L2 antibody LS-C749292 is an unconjugated rabbit polyclonal antibody to NDUFA4L2 from human. It is reactive with human, mouse and rat. Validated for WB.

Klonalität:	Polyclonal
NCBI:	56901
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 9kDa, while the observed MW by Western blot was 12kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten