Polyclonal Rabbit anti-Human NDUFA4L2 Antibody (WB) LS-C749292

Catalog Number: LS-C749292-20

Images (0)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human NDUFA4L2 Antibody (WB) LS-C749292
Biozol Catalog Number:	LS-C749292-20
Supplier Catalog Number:	LS-C749292-20
Alternative Catalog Number:	LS-C749292-20
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human NDUFA4L2 (NP_064527.1). MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF
Conjugation:	Unconjugated
Alternative Names:	NDUFA4L2, NUOMS

NDUFA4L2 antibody LS-C749292 is an unconjugated rabbit polyclonal antibody to NDUFA4L2 from human. It is reactive with human, mouse and rat. Validated for WB.

Clonality:	Polyclonal
NCBI:	56901
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	WB (1:500 - 1:2000)
Application Notes:	The predicted MW is 9kDa, while the observed MW by Western blot was 12kDa.

* VAT and and shipping costs not included.
Errors and price changes excepted