Polyclonal Rabbit anti-Human GREM2 / Gremlin 2 Antibody (WB) LS-C749293

Artikelnummer: LS-C749293-100

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human GREM2 / Gremlin 2 Antibody (WB) LS-C749293
Artikelnummer:	LS-C749293-100
Hersteller Artikelnummer:	LS-C749293-100
Alternativnummer:	LS-C749293-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human GREM2 (NP_071914.3). MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
Konjugation:	Unconjugated
Alternative Synonym:	GREM2, CKTSF1B2, DAN domain family member 3, DAND3, Gremlin-2, Gremlin 2, PRDC

Gremlin 2 antibody LS-C749293 is an unconjugated rabbit polyclonal antibody to Gremlin 2 (GREM2) from human. It is reactive with human, mouse and rat. Validated for WB.

Klonalität:	Polyclonal
NCBI:	64388
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 19kDa, while the observed MW by Western blot was 19kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten