Polyclonal Rabbit anti-Human GREM2 / Gremlin 2 Antibody (WB) LS-C749293

Catalog Number: LS-C749293-100

Images (0)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human GREM2 / Gremlin 2 Antibody (WB) LS-C749293
Biozol Catalog Number:	LS-C749293-100
Supplier Catalog Number:	LS-C749293-100
Alternative Catalog Number:	LS-C749293-100
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human GREM2 (NP_071914.3). MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
Conjugation:	Unconjugated
Alternative Names:	GREM2, CKTSF1B2, DAN domain family member 3, DAND3, Gremlin-2, Gremlin 2, PRDC

Gremlin 2 antibody LS-C749293 is an unconjugated rabbit polyclonal antibody to Gremlin 2 (GREM2) from human. It is reactive with human, mouse and rat. Validated for WB.

Clonality:	Polyclonal
NCBI:	64388
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	WB (1:500 - 1:2000)
Application Notes:	The predicted MW is 19kDa, while the observed MW by Western blot was 19kDa.

* VAT and and shipping costs not included.
Errors and price changes excepted