Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human GREM2 (NP_071914.3). MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
Conjugation:
Unconjugated
Alternative Names:
GREM2, CKTSF1B2, DAN domain family member 3, DAND3, Gremlin-2, Gremlin 2, PRDC
Gremlin 2 antibody LS-C749293 is an unconjugated rabbit polyclonal antibody to Gremlin 2 (GREM2) from human. It is reactive with human, mouse and rat. Validated for WB.