Polyclonal Rabbit anti-Human MYLK2 Antibody (WB) LS-C749299

Artikelnummer: LS-C749299-20
Artikelname: Polyclonal Rabbit anti-Human MYLK2 Antibody (WB) LS-C749299
Artikelnummer: LS-C749299-20
Hersteller Artikelnummer: LS-C749299-20
Alternativnummer: LS-C749299-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MYLK2 (NP_149109.1). MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGS
Konjugation: Unconjugated
Alternative Synonym: MYLK2, KMLC, MLCK2, MLCK, Myosin light chain kinase 2, SkMLCK
MYLK2 antibody LS-C749299 is an unconjugated rabbit polyclonal antibody to MYLK2 from human. It is reactive with human and mouse. Validated for WB.
Klonalität: Polyclonal
NCBI: 85366
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 64kDa, while the observed MW by Western blot was 65kDa.