Polyclonal Rabbit anti-Human MYLK2 Antibody (WB) LS-C749299

Catalog Number: LS-C749299-20
Article Name: Polyclonal Rabbit anti-Human MYLK2 Antibody (WB) LS-C749299
Biozol Catalog Number: LS-C749299-20
Supplier Catalog Number: LS-C749299-20
Alternative Catalog Number: LS-C749299-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MYLK2 (NP_149109.1). MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGS
Conjugation: Unconjugated
Alternative Names: MYLK2, KMLC, MLCK2, MLCK, Myosin light chain kinase 2, SkMLCK
MYLK2 antibody LS-C749299 is an unconjugated rabbit polyclonal antibody to MYLK2 from human. It is reactive with human and mouse. Validated for WB.
Clonality: Polyclonal
NCBI: 85366
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 64kDa, while the observed MW by Western blot was 65kDa.