Polyclonal Rabbit anti-Human RXFP2 / LGR8 Antibody (WB) LS-C749303

Artikelnummer: LS-C749303-100

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human RXFP2 / LGR8 Antibody (WB) LS-C749303
Artikelnummer:	LS-C749303-100
Hersteller Artikelnummer:	LS-C749303-100
Alternativnummer:	LS-C749303-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human RXFP2 (NP_570718.1). CGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKA
Konjugation:	Unconjugated
Alternative Synonym:	RXFP2, G-protein coupled receptor 106, GPR106, INSL3R, LGR8, GREAT, Relaxin receptor 2, LGR8.1, RXFPR2

LGR8 antibody LS-C749303 is an unconjugated rabbit polyclonal antibody to LGR8 (RXFP2) from human. It is reactive with human, mouse and rat. Validated for WB.

Klonalität:	Polyclonal
NCBI:	122042
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 83kDa/86kDa, while the observed MW by Western blot was 89kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten