Polyclonal Rabbit anti-Human RXFP2 / LGR8 Antibody (WB) LS-C749303

Catalog Number: LS-C749303-100

Images (0)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human RXFP2 / LGR8 Antibody (WB) LS-C749303
Biozol Catalog Number:	LS-C749303-100
Supplier Catalog Number:	LS-C749303-100
Alternative Catalog Number:	LS-C749303-100
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	WB
Species Reactivity:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human RXFP2 (NP_570718.1). CGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKA
Conjugation:	Unconjugated
Alternative Names:	RXFP2, G-protein coupled receptor 106, GPR106, INSL3R, LGR8, GREAT, Relaxin receptor 2, LGR8.1, RXFPR2

LGR8 antibody LS-C749303 is an unconjugated rabbit polyclonal antibody to LGR8 (RXFP2) from human. It is reactive with human, mouse and rat. Validated for WB.

Clonality:	Polyclonal
NCBI:	122042
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	WB (1:500 - 1:2000)
Application Notes:	The predicted MW is 83kDa/86kDa, while the observed MW by Western blot was 89kDa.

* VAT and and shipping costs not included.
Errors and price changes excepted