Warenkorb

Produktsuche

Home
Produkte
Polyclonal Rabbit anti-Human ZNF157 Antibody (WB) LS-C749329

Polyclonal Rabbit anti-Human ZNF157 Antibody (WB) LS-C749329

Artikelnummer: LS-C749329-20

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human ZNF157 Antibody (WB) LS-C749329
Artikelnummer:	LS-C749329-20
Hersteller Artikelnummer:	LS-C749329-20
Alternativnummer:	LS-C749329-20
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 70-165 of human ZNF157 (NP_003437.2). VAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECH
Konjugation:	Unconjugated
Alternative Synonym:	ZNF157, HZF22, Zinc finger protein 22, Zinc finger protein 157, Zinc finger protein HZF22

ZNF157 antibody LS-C749329 is an unconjugated rabbit polyclonal antibody to human ZNF157. Validated for WB.

Klonalität:	Polyclonal
NCBI:	7712
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 58kDa, while the observed MW by Western blot was 58kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten