Polyclonal Rabbit anti-Human ZNF157 Antibody (WB) LS-C749329

Catalog Number: LS-C749329-20
Article Name: Polyclonal Rabbit anti-Human ZNF157 Antibody (WB) LS-C749329
Biozol Catalog Number: LS-C749329-20
Supplier Catalog Number: LS-C749329-20
Alternative Catalog Number: LS-C749329-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-165 of human ZNF157 (NP_003437.2). VAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECH
Conjugation: Unconjugated
Alternative Names: ZNF157, HZF22, Zinc finger protein 22, Zinc finger protein 157, Zinc finger protein HZF22
ZNF157 antibody LS-C749329 is an unconjugated rabbit polyclonal antibody to human ZNF157. Validated for WB.
Clonality: Polyclonal
NCBI: 7712
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: WB (1:500 - 1:2000)
Application Notes: The predicted MW is 58kDa, while the observed MW by Western blot was 58kDa.
494,00 €
20 µl
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL